Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries) |
Domain d1rxof_: 1rxo F: [39643] Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2 complexed with ca, rub |
PDB Entry: 1rxo (more details), 2.2 Å
SCOPe Domain Sequences for d1rxof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rxof_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]} mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp agy
Timeline for d1rxof_: