SCOP 1.61: Domain d1rxos_: 1rxo S:

Lineage for d1rxos_ (1rxo S:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1rxos_: 1rxo S: [39641]
   Other proteins in same PDB: d1rxob1, d1rxob2, d1rxoe1, d1rxoe2, d1rxoh1, d1rxoh2, d1rxol1, d1rxol2

Details for d1rxos_

PDB Entry: 1rxo, 2.2 Å

PDB Description: activated spinach rubisco in complex with its substrate ribulose-1,5-bisphosphate and calcium

SCOP Domain Sequences for d1rxos_:

Sequence; same for both SEQRES and ATOM records:

>d1rxos_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1rxos_:

• d1rxos_ first appeared (with stable ids) in SCOP 1.55
  
• d1rxos_ appears in SCOP 1.59
  
• d1rxos_ appears in SCOP 1.63
  
• d1rxos_ appears in the current release, SCOPe 2.08