SCOP 1.59: Domain d1aa1i_: 1aa1 I:

Lineage for d1aa1i_ (1aa1 I:)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (8 PDB entries)

8. Domain d1aa1i_: 1aa1 I: [39640]
   Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2

Details for d1aa1i_

PDB Entry: 1aa1, 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

SCOP Domain Sequences for d1aa1i_:

Sequence; same for both SEQRES and ATOM records:

>d1aa1i_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea)}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1aa1i_:

• d1aa1i_ first appeared (with stable ids) in SCOP 1.55
  
• d1aa1i_ appears in SCOP 1.57
  
• d1aa1i_ appears in SCOP 1.61
  
• d1aa1i_ appears in the current release, SCOPe 2.08