SCOPe 2.03: Domain d1aa1f_: 1aa1 F:

Lineage for d1aa1f_ (1aa1 F:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)

8. Domain d1aa1f_: 1aa1 F: [39639]
   Other proteins in same PDB: d1aa1b1, d1aa1b2, d1aa1e1, d1aa1e2, d1aa1h1, d1aa1h2, d1aa1l1, d1aa1l2
   complexed with 3pg, mg

Details for d1aa1f_

PDB Entry: 1aa1, 2.2 Å

PDB Description: activated spinach rubisco in complex with the product 3-phosphoglycerate

PDB Compounds: (F:) ribulose bisphosphate carboxylase (small chain)

SCOPe Domain Sequences for d1aa1f_:

Sequence; same for both SEQRES and ATOM records:

>d1aa1f_ d.73.1.1 (F:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

Timeline for d1aa1f_:

• d1aa1f_ first appeared (with stable ids) in SCOP 1.55
  
• d1aa1f_ appears in SCOPe 2.02
  
• d1aa1f_ appears in SCOPe 2.04
  
• d1aa1f_ appears in the current release, SCOPe 2.08