SCOPe 2.07: Domain d6xcjl1: 6xcj L:1-112

Lineage for d6xcjl1 (6xcj L:1-112)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Rhesus monkey (Macaca mulatta) [TaxId:9544] [226133] (33 PDB entries)

8. Domain d6xcjl1: 6xcj L:1-112 [396377]
   Other proteins in same PDB: d6xcjl2
   automated match to d1dn0a1
   complexed with nag

Details for d6xcjl1

PDB Entry: 6xcj, 2.8 Å

PDB Description: crystal structure of dh650 fab from a rhesus macaque in complex with hiv-1 gp120 core

PDB Compounds: (L:) DH650 Fab Light Chain

SCOPe Domain Sequences for d6xcjl1:

Sequence; same for both SEQRES and ATOM records:

>d6xcjl1 b.1.1.0 (L:1-112) automated matches {Rhesus monkey (Macaca mulatta) [TaxId: 9544]}
divmtqsplslpvtpgepaaiscrssqslldradgntyldwylqkpgqspqlliyevsnr
asgvpdrfsgsgsdtdftlkisrveaedvgvyycmqglefpysfgqgtkvei

Timeline for d6xcjl1:

• d6xcjl1 is new in SCOPe 2.07-stable
  
• d6xcjl1 appears in the current release, SCOPe 2.08