Lineage for d1rboi_ (1rbo I:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1913207Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1913208Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1913209Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1913210Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1913287Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 1913298Domain d1rboi_: 1rbo I: [39636]
    Other proteins in same PDB: d1rbob1, d1rbob2, d1rboe1, d1rboe2, d1rboh1, d1rboh2, d1rbol1, d1rbol2
    complexed with cap

Details for d1rboi_

PDB Entry: 1rbo (more details), 2.3 Å

PDB Description: spinach rubisco in complex with the inhibitor 2-carboxyarabinitol-1,5- diphosphate
PDB Compounds: (I:) ribulose bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d1rboi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rboi_ d.73.1.1 (I:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d1rboi_:

Click to download the PDB-style file with coordinates for d1rboi_.
(The format of our PDB-style files is described here.)

Timeline for d1rboi_: