Lineage for d8rucl_ (8ruc L:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2200260Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 2200261Superfamily d.73.1: RuBisCO, small subunit [55239] (2 families) (S)
  5. 2200262Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 2200263Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 2200340Species Spinach (Spinacia oleracea) [TaxId:3562] [55243] (10 PDB entries)
  8. 2200344Domain d8rucl_: 8ruc L: [39632]
    Other proteins in same PDB: d8ruca1, d8ruca2, d8rucc1, d8rucc2, d8ruce1, d8ruce2, d8rucg1, d8rucg2
    complexed with cap, mg

Details for d8rucl_

PDB Entry: 8ruc (more details), 1.6 Å

PDB Description: activated spinach rubisco complexed with 2-carboxyarabinitol bisphosphate
PDB Compounds: (L:) ribulose-1,5-bisphosphate carboxylase/oxygenase

SCOPe Domain Sequences for d8rucl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d8rucl_ d.73.1.1 (L:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Spinach (Spinacia oleracea) [TaxId: 3562]}
mqvwpilnlkkyetlsylpplttdqlarqvdyllnnkwvpclefetdhgfvyrehhnspg
yydgrywtmwklpmfgctdpaqvlneleeckkeypnafiriigfdsnrevqcisfiaykp
agy

SCOPe Domain Coordinates for d8rucl_:

Click to download the PDB-style file with coordinates for d8rucl_.
(The format of our PDB-style files is described here.)

Timeline for d8rucl_: