Lineage for d4rubu_ (4rub U:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1208801Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
    alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta
  4. 1208802Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 1208803Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)
  6. 1208804Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)
  7. 1208951Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 1208959Domain d4rubu_: 4rub U: [39623]
    Other proteins in same PDB: d4ruba1, d4ruba2, d4rubb1, d4rubb2, d4rubc1, d4rubc2, d4rubd1, d4rubd2
    complexed with cap, fmt, mg

Details for d4rubu_

PDB Entry: 4rub (more details), 2.7 Å

PDB Description: a crystal form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from nicotiana tabacum in the activated state
PDB Compounds: (U:) ribulose 1,5-bisphosphate carboxylase/oxygenase (form IV)

SCOPe Domain Sequences for d4rubu_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rubu_ d.73.1.1 (U:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaevgeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOPe Domain Coordinates for d4rubu_:

Click to download the PDB-style file with coordinates for d4rubu_.
(The format of our PDB-style files is described here.)

Timeline for d4rubu_: