Lineage for d1rlcs_ (1rlc S:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193350Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 193351Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 193352Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 193353Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 193426Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 193431Domain d1rlcs_: 1rlc S: [39620]
    Other proteins in same PDB: d1rlcl1, d1rlcl2

Details for d1rlcs_

PDB Entry: 1rlc (more details), 2.7 Å

PDB Description: crystal structure of the unactivated ribulose 1, 5-bisphosphate carboxylase(slash)oxygenase complexed with a transition state analog, 2-carboxy-d-arabinitol 1,5-bisphosphate

SCOP Domain Sequences for d1rlcs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlcs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOP Domain Coordinates for d1rlcs_:

Click to download the PDB-style file with coordinates for d1rlcs_.
(The format of our PDB-style files is described here.)

Timeline for d1rlcs_: