Lineage for d6wx8d_ (6wx8 D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697956Fold a.21: HMG-box [47094] (1 superfamily)
    3 helices; irregular array
  4. 2697957Superfamily a.21.1: HMG-box [47095] (2 families) (S)
  5. 2697958Family a.21.1.1: HMG-box [47096] (10 proteins)
  6. 2697999Protein Sox-2 [81718] (2 species)
  7. 2698000Species Human (Homo sapiens) [TaxId:9606] [101105] (3 PDB entries)
  8. 2698002Domain d6wx8d_: 6wx8 D: [396191]
    Other proteins in same PDB: d6wx8a_, d6wx8c_
    automated match to d1o4xb_
    complexed with so4

Details for d6wx8d_

PDB Entry: 6wx8 (more details), 2.3 Å

PDB Description: sox2 bound to importin-alpha 3
PDB Compounds: (D:) transcription factor sox-2

SCOPe Domain Sequences for d6wx8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6wx8d_ a.21.1.1 (D:) Sox-2 {Human (Homo sapiens) [TaxId: 9606]}
rvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlra
lhmkehpdykyrprrktktlm

SCOPe Domain Coordinates for d6wx8d_:

Click to download the PDB-style file with coordinates for d6wx8d_.
(The format of our PDB-style files is described here.)

Timeline for d6wx8d_: