Lineage for d1ej7s_ (1ej7 S:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33418Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 33419Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 33420Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 33421Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (5 species)
  7. 33473Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 33475Domain d1ej7s_: 1ej7 S: [39617]
    Other proteins in same PDB: d1ej7l1, d1ej7l2

Details for d1ej7s_

PDB Entry: 1ej7 (more details), 2.45 Å

PDB Description: crystal structure of unactivated tobacco rubisco with bound phosphate ions

SCOP Domain Sequences for d1ej7s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej7s_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOP Domain Coordinates for d1ej7s_:

Click to download the PDB-style file with coordinates for d1ej7s_.
(The format of our PDB-style files is described here.)

Timeline for d1ej7s_: