SCOPe 2.03: Domain d3rubs_: 3rub S:

Lineage for d3rubs_ (3rub S:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
   alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta

4. Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family)

5. Family d.73.1.1: RuBisCO, small subunit [55240] (2 proteins)

6. Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species)

7. Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)

8. Domain d3rubs_: 3rub S: [39616]
   Other proteins in same PDB: d3rubl1, d3rubl2
   complexed with asn, so4

Details for d3rubs_

PDB Entry: 3rub, 2 Å

PDB Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution

PDB Compounds: (S:) ribulose 1,5-bisphosphate carboxylase/oxygenase, form III

SCOPe Domain Sequences for d3rubs_:

Sequence; same for both SEQRES and ATOM records:

>d3rubs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

Timeline for d3rubs_:

• d3rubs_ first appeared (with stable ids) in SCOP 1.55
  
• d3rubs_ appears in SCOPe 2.02
  
• d3rubs_ appears in SCOPe 2.04
  
• d3rubs_ appears in the current release, SCOPe 2.08