Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.73: RuBisCO, small subunit [55238] (1 superfamily) alpha-beta(2)-alpha-beta(2); 2 layers, alpha/beta |
Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) |
Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein) |
Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (8 species) |
Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries) |
Domain d3rubs_: 3rub S: [39616] Other proteins in same PDB: d3rubl1, d3rubl2 complexed with so4 |
PDB Entry: 3rub (more details), 2 Å
SCOP Domain Sequences for d3rubs_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rubs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId: 4097]} mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp egy
Timeline for d3rubs_: