Lineage for d3rubs_ (3rub S:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 134572Fold d.73: RuBisCO, small subunit [55238] (1 superfamily)
  4. 134573Superfamily d.73.1: RuBisCO, small subunit [55239] (1 family) (S)
  5. 134574Family d.73.1.1: RuBisCO, small subunit [55240] (1 protein)
  6. 134575Protein Ribulose 1,5-bisphosphate carboxylase-oxygenase [55241] (6 species)
  7. 134632Species Tobacco (Nicotiana tabacum), variant turkish samsun [TaxId:4097] [55242] (5 PDB entries)
  8. 134633Domain d3rubs_: 3rub S: [39616]
    Other proteins in same PDB: d3rubl1, d3rubl2

Details for d3rubs_

PDB Entry: 3rub (more details), 2 Å

PDB Description: crystal structure of the unactivated form of ribulose-1,5-bisphosphate carboxylase(slash)oxygenase from tobacco refined at 2.0-angstroms resolution

SCOP Domain Sequences for d3rubs_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rubs_ d.73.1.1 (S:) Ribulose 1,5-bisphosphate carboxylase-oxygenase {Tobacco (Nicotiana tabacum), variant turkish samsun}
mqvwppinkkkyetlsylpdlsqeqllseveyllkngwvpclefetehgfvyrennkspg
yydgrywtmwklpmfgctdatqvlaeveeakkaypqawiriigfdnvrqvqcisfiaykp
egy

SCOP Domain Coordinates for d3rubs_:

Click to download the PDB-style file with coordinates for d3rubs_.
(The format of our PDB-style files is described here.)

Timeline for d3rubs_: