Lineage for d6w3zd_ (6w3z D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862580Family c.31.1.1: Deoxyhypusine synthase, DHS [52468] (2 proteins)
    automatically mapped to Pfam PF01916
  6. 2862609Protein automated matches [396027] (1 species)
    not a true protein
  7. 2862610Species Nematode (Brugia malayi) [TaxId:6279] [396028] (1 PDB entry)
  8. 2862614Domain d6w3zd_: 6w3z D: [396071]
    automated match to d1dhsa_
    complexed with cl, gol, nad

Details for d6w3zd_

PDB Entry: 6w3z (more details), 2.3 Å

PDB Description: crystal structure of brugia malayi deoxyhypusine synthase (dhps)
PDB Compounds: (D:) BMA-DHPS-1, isoform a

SCOPe Domain Sequences for d6w3zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6w3zd_ c.31.1.1 (D:) automated matches {Nematode (Brugia malayi) [TaxId: 6279]}
emsvlkksstmpadstiikgydfneginydalldqymstgfqashfaqavqqintmltir
eeqfegdhtlpypegkqkractiflgytsnlvtsgvrenirylvehdlvdcivtsaggve
edlikclapsylgafdldgktlrhnglnragniiipnnnycqfedwlmpildsceleqkn
ndfswtpsklidrlgaeindkrsicywahrnripvfspaltdgsigdmlyfhsfrnggik
ldivedlrhintmavrsnrtgvillgggvmkhhinnanlmrngsdyavyvntgqefdgsd
sgarpdeavswgkvrsdcrpvkiyadatlvfpllvaktfarhvqqk

SCOPe Domain Coordinates for d6w3zd_:

Click to download the PDB-style file with coordinates for d6w3zd_.
(The format of our PDB-style files is described here.)

Timeline for d6w3zd_: