Lineage for d6uupc1 (6uup C:1-119)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754052Species Camelidae mixed [TaxId:1579311] [394368] (5 PDB entries)
  8. 2754059Domain d6uupc1: 6uup C:1-119 [395904]
    automated match to d5c6wh1
    complexed with gol, k, peg, trs

Details for d6uupc1

PDB Entry: 6uup (more details), 2.2 Å

PDB Description: structure of anti-hcd33 conditional scfv
PDB Compounds: (C:) Anti-CD33 conditional scFv

SCOPe Domain Sequences for d6uupc1:

Sequence, based on SEQRES records: (download)

>d6uupc1 b.1.1.0 (C:1-119) automated matches {Camelidae mixed [TaxId: 1579311]}
qvqlvesggglvqaggslrlscaasrrssrswamhwvrqapgkglewvavisydgrlkyy
adsvkgrftisrdnaeylvylqmnslraedtavyycaaeegdggffdywgqgtlvtvss

Sequence, based on observed residues (ATOM records): (download)

>d6uupc1 b.1.1.0 (C:1-119) automated matches {Camelidae mixed [TaxId: 1579311]}
qvqlvesggglvqaggslrlscaasrrssrswamhwvrqapgkglewvavisydgrlkyy
adsvkgrftisrdnylvylqmnslraedtavyycaaeegdggffdywgqgtlvtvss

SCOPe Domain Coordinates for d6uupc1:

Click to download the PDB-style file with coordinates for d6uupc1.
(The format of our PDB-style files is described here.)

Timeline for d6uupc1: