SCOPe 2.08: Domain d6uupd2: 6uup D:144-255

Lineage for d6uupd2 (6uup D:144-255)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Camelidae mixed [TaxId:1579311] [394368] (5 PDB entries)

8. Domain d6uupd2: 6uup D:144-255 [395864]
   automated match to d5cbed_
   complexed with gol, k, peg, trs

Details for d6uupd2

PDB Entry: 6uup, 2.2 Å

PDB Description: structure of anti-hcd33 conditional scfv

PDB Compounds: (D:) Anti-CD33 conditional scFv

SCOPe Domain Sequences for d6uupd2:

Sequence, based on SEQRES records:

>d6uupd2 b.1.1.0 (D:144-255) automated matches {Camelidae mixed [TaxId: 1579311]}
vltqppsasgtpgqrvtiscsgsssnigsnyvnwyqqlpgtapklliyrnnerpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawdgslsgrgvfgtgtkltvlenl

Sequence, based on observed residues (ATOM records):

>d6uupd2 b.1.1.0 (D:144-255) automated matches {Camelidae mixed [TaxId: 1579311]}
vltqppsasgtpgqrvtiscsgsssnigsnyvnwyqqlpgtapklliyrnnerpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawdgsgrgvfgtgtkltvlenl

Timeline for d6uupd2:

• d6uupd2 first appeared in SCOPe 2.07