Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Camelidae mixed [TaxId:1579311] [394368] (5 PDB entries) |
Domain d6uupd2: 6uup D:144-255 [395864] automated match to d5cbed_ complexed with gol, k, peg, trs |
PDB Entry: 6uup (more details), 2.2 Å
SCOPe Domain Sequences for d6uupd2:
Sequence, based on SEQRES records: (download)
>d6uupd2 b.1.1.0 (D:144-255) automated matches {Camelidae mixed [TaxId: 1579311]} vltqppsasgtpgqrvtiscsgsssnigsnyvnwyqqlpgtapklliyrnnerpsgvpdr fsgsksgtsaslaisglrsedeadyycaawdgslsgrgvfgtgtkltvlenl
>d6uupd2 b.1.1.0 (D:144-255) automated matches {Camelidae mixed [TaxId: 1579311]} vltqppsasgtpgqrvtiscsgsssnigsnyvnwyqqlpgtapklliyrnnerpsgvpdr fsgsksgtsaslaisglrsedeadyycaawdgsgrgvfgtgtkltvlenl
Timeline for d6uupd2: