SCOPe 2.07: Domain d6tnpd1: 6tnp D:6-115

Lineage for d6tnpd1 (6tnp D:6-115)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
Domain d6tnpd1: 6tnp D:6-115 [395827]
Other proteins in same PDB: d6tnpb2, d6tnpd2, d6tnpf2, d6tnph2, d6tnpi2, d6tnpk2
automated match to d1oauh_
complexed with no8

Details for d6tnpd1

PDB Description: crystal structure of the scfv-5e5 in complex with a tn glycopeptide

PDB Compounds: (D:) Heavy chain of our ScFv-5E5

SCOPe Domain Sequences for d6tnpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6tnpd1 b.1.1.1 (D:6-115) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qsdaelvkpgssvkisckasgytftdhaihwvkqkpeqglewighfspgntdikyndkfk
gkatltvdrssstaymqlnsltsedsavyfcktstfffdywgqgttltvs

SCOPe Domain Coordinates for d6tnpd1:

Click to download the PDB-style file with coordinates for d6tnpd1.
(The format of our PDB-style files is described here.)

Timeline for d6tnpd1: