Lineage for d6t3ya2 (6t3y A:87-186)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365383Species Chicken (Gallus gallus) [TaxId:9031] [188287] (25 PDB entries)
  8. 2365394Domain d6t3ya2: 6t3y A:87-186 [395794]
    Other proteins in same PDB: d6t3ya1, d6t3ya3
    automated match to d5ujta2
    complexed with act, gol

Details for d6t3ya2

PDB Entry: 6t3y (more details), 1.7 Å

PDB Description: improved high resolution structure of mhc class ii complex
PDB Compounds: (A:) MHC class II alpha chain

SCOPe Domain Sequences for d6t3ya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t3ya2 b.1.1.0 (A:87-186) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qdfvtpelalfpaeavsleepnvlicyadkfwppvatmewrrngavvsegvydsvyygrp
dllfrkfsylpfvpqrgdvyscavrhwgaegpvqrmwepe

SCOPe Domain Coordinates for d6t3ya2:

Click to download the PDB-style file with coordinates for d6t3ya2.
(The format of our PDB-style files is described here.)

Timeline for d6t3ya2: