Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (5 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries) |
Domain d6t3ya1: 6t3y A:6-86 [395793] Other proteins in same PDB: d6t3ya2, d6t3ya3 automated match to d5ujta1 complexed with act, gol |
PDB Entry: 6t3y (more details), 1.7 Å
SCOPe Domain Sequences for d6t3ya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t3ya1 d.19.1.0 (A:6-86) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} hvllqaefyqrsegpdkawaqfgfhfdadelfhveldaaqtvwrlpefgrfasfeaqgal qnmavgkqnlevmisnsnrsq
Timeline for d6t3ya1: