SCOPe 2.08: Domain d6t5fc1: 6t5f C:1-233

Lineage for d6t5fc1 (6t5f C:1-233)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d6t5fc1: 6t5f C:1-233 [395751]
   Other proteins in same PDB: d6t5fa2, d6t5fb2, d6t5fc2
   automated match to d4dnkb_
   complexed with sep

Details for d6t5fc1

PDB Entry: 6t5f, 2.63 Å

PDB Description: human 14-3-3 sigma fused to the stard1 peptide including phosphoserine-195

PDB Compounds: (C:) 14-3-3 protein sigma

SCOPe Domain Sequences for d6t5fc1:

Sequence; same for both SEQRES and ATOM records:

>d6t5fc1 a.118.7.1 (C:1-233) automated matches {Human (Homo sapiens) [TaxId: 9606]}
merasliqkaklaeqaeryedmaafmkgavekgeelsceernllsvayknvvggqraawr
vlssieqksneegsaaagpevreyrekvetelqgvcdtvlglldshlikeagdaesrvfy
lkmkgdyyrylaevatgddkkriidsarsayqeamdiskkempptnpirlglalnfsvfh
yeianspeeaislakttfdeamadlhtlsedsykdstlimqllrdnltlwtgs

Timeline for d6t5fc1:

• d6t5fc1 first appeared in SCOPe 2.07