Lineage for d2ifea_ (2ife A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2199715Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2199716Superfamily d.68.1: Translation initiation factor IF3, C-terminal domain [55200] (2 families) (S)
    automatically mapped to Pfam PF00707
  5. 2199717Family d.68.1.1: Translation initiation factor IF3, C-terminal domain [55201] (1 protein)
  6. 2199718Protein Translation initiation factor IF3, C-terminal domain [55202] (3 species)
  7. 2199721Species Escherichia coli [TaxId:562] [55204] (1 PDB entry)
  8. 2199722Domain d2ifea_: 2ife A: [39567]

Details for d2ifea_

PDB Entry: 2ife (more details)

PDB Description: translation initiation factor if3 from escherichia coli ribosome binding domain (residues 84-180)
PDB Compounds: (A:) protein (translation initiation factor if3)

SCOPe Domain Sequences for d2ifea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifea_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Escherichia coli [TaxId: 562]}
viqvkeikfrpgtdegdyqvklrslirfleegdkakitlrfrgremahqqigmevlnrvk
ddlqelavvesfptkiegrqmimvlapkkkq

SCOPe Domain Coordinates for d2ifea_:

Click to download the PDB-style file with coordinates for d2ifea_.
(The format of our PDB-style files is described here.)

Timeline for d2ifea_: