Lineage for d2ifea_ (2ife A:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 33329Fold d.68: IF3-like [55199] (2 superfamilies)
  4. 33330Superfamily d.68.1: Translation initiation factor IF3 [55200] (1 family) (S)
  5. 33331Family d.68.1.1: Translation initiation factor IF3 [55201] (1 protein)
  6. 33332Protein Translation initiation factor IF3 [55202] (2 species)
  7. 33335Species Escherichia coli [TaxId:562] [55204] (1 PDB entry)
  8. 33336Domain d2ifea_: 2ife A: [39567]

Details for d2ifea_

PDB Entry: 2ife (more details)

PDB Description: translation initiation factor if3 from escherichia coli ribosome binding domain (residues 84-180)

SCOP Domain Sequences for d2ifea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ifea_ d.68.1.1 (A:) Translation initiation factor IF3 {Escherichia coli}
viqvkeikfrpgtdegdyqvklrslirfleegdkakitlrfrgremahqqigmevlnrvk
ddlqelavvesfptkiegrqmimvlapkkkq

SCOP Domain Coordinates for d2ifea_:

Click to download the PDB-style file with coordinates for d2ifea_.
(The format of our PDB-style files is described here.)

Timeline for d2ifea_: