Class a: All alpha proteins [46456] (290 folds) |
Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies) core: 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.11.2: Second domain of FERM [47031] (2 families) automatically mapped to Pfam PF00373 |
Family a.11.2.0: automated matches [254193] (1 protein) not a true family |
Protein automated matches [254423] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255207] (60 PDB entries) |
Domain d5rz4a2: 5rz4 A:191-296 [395667] Other proteins in same PDB: d5rz4a1, d5rz4a3 automated match to d2he7a2 complexed with dms, edo, wh7 |
PDB Entry: 5rz4 (more details), 1.61 Å
SCOPe Domain Sequences for d5rz4a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5rz4a2 a.11.2.0 (A:191-296) automated matches {Human (Homo sapiens) [TaxId: 9606]} pdpaqlseditryylclqlrddivsgrlpcsfvtlallgsytvqselgdydpdecgsdyi sefrfapnhtkeledkvielhkshrgmtpaeaemhflenakklsmy
Timeline for d5rz4a2: