![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.68: IF3-like [55199] (7 superfamilies) beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest |
![]() | Superfamily d.68.1: Translation initiation factor IF3, C-terminal domain [55200] (1 family) ![]() |
![]() | Family d.68.1.1: Translation initiation factor IF3, C-terminal domain [55201] (1 protein) |
![]() | Protein Translation initiation factor IF3, C-terminal domain [55202] (3 species) |
![]() | Species Bacillus stearothermophilus [TaxId:1422] [55203] (1 PDB entry) |
![]() | Domain d1tiga_: 1tig A: [39566] |
PDB Entry: 1tig (more details), 2 Å
SCOP Domain Sequences for d1tiga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tiga_ d.68.1.1 (A:) Translation initiation factor IF3, C-terminal domain {Bacillus stearothermophilus [TaxId: 1422]} invkevrlsptieehdfntklrnarkflekgdkvkatirfkgraithkeigqrvldrlse acadiavvetapkmdgrnmflvlapknd
Timeline for d1tiga_: