Lineage for d1eh1a_ (1eh1 A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 864674Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 864714Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 864715Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 864716Protein Ribosome recycling factor, RRF [55196] (7 species)
  7. 864733Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)
  8. 864734Domain d1eh1a_: 1eh1 A: [39565]

Details for d1eh1a_

PDB Entry: 1eh1 (more details), 2.6 Å

PDB Description: ribosome recycling factor from thermus thermophilus
PDB Compounds: (A:) ribosome recycling factor

SCOP Domain Sequences for d1eh1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

SCOP Domain Coordinates for d1eh1a_:

Click to download the PDB-style file with coordinates for d1eh1a_.
(The format of our PDB-style files is described here.)

Timeline for d1eh1a_: