SCOPe 2.08: Domain d1eh1a_: 1eh1 A:

Lineage for d1eh1a_ (1eh1 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
   core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta

4. Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (2 families)
   automatically mapped to Pfam PF01765

5. Family d.67.3.1: Ribosome recycling factor, RRF [55195] (2 proteins)

6. Protein Ribosome recycling factor, RRF [55196] (7 species)

7. Species Thermus thermophilus [TaxId:274] [55198] (9 PDB entries)

8. Domain d1eh1a_: 1eh1 A: [39565]

Details for d1eh1a_

PDB Entry: 1eh1, 2.6 Å

PDB Description: ribosome recycling factor from thermus thermophilus

PDB Compounds: (A:) ribosome recycling factor

SCOPe Domain Sequences for d1eh1a_:

Sequence; same for both SEQRES and ATOM records:

>d1eh1a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermus thermophilus [TaxId: 274]}
mtlkelyaetrshmqkslevlehnlaglrtgranpalllhlkveyygahvplnqiatvta
pdprtlvvqswdqnalkaiekairdsdlglnpsnkgdalyinipplteerrkdlvravrq
yaeegrvairnirrealdklkklakelhlsedetkraeaeiqkitdefiakadqlaekke
qeilg

Timeline for d1eh1a_:

• d1eh1a_ first appeared (with stable ids) in SCOP 1.55
  
• d1eh1a_ appears in SCOPe 2.07