Lineage for d1dd5a_ (1dd5 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193222Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (3 superfamilies)
  4. 193237Superfamily d.67.3: Ribosome recycling factor, RRF [55194] (1 family) (S)
  5. 193238Family d.67.3.1: Ribosome recycling factor, RRF [55195] (1 protein)
  6. 193239Protein Ribosome recycling factor, RRF [55196] (4 species)
  7. 193244Species Thermotoga maritima [TaxId:243274] [55197] (1 PDB entry)
  8. 193245Domain d1dd5a_: 1dd5 A: [39564]

Details for d1dd5a_

PDB Entry: 1dd5 (more details), 2.55 Å

PDB Description: crystal structure of thermotoga maritima ribosome recycling factor, rrf

SCOP Domain Sequences for d1dd5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dd5a_ d.67.3.1 (A:) Ribosome recycling factor, RRF {Thermotoga maritima}
vnpfikeakekmkrtlekiedelrkmrtgkpspaileeikvdyygvptpvnqlatisise
ertlvikpwdksvlsliekainasdlglnpindgnvirlvfpsptteqrekwvkkakeiv
eegkiairnirreilkkikedqkeglipeddakrleneiqkltdefiekldevfeikkee
imef

SCOP Domain Coordinates for d1dd5a_:

Click to download the PDB-style file with coordinates for d1dd5a_.
(The format of our PDB-style files is described here.)

Timeline for d1dd5a_: