Lineage for d1dm9a_ (1dm9 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 605384Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 605385Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 605410Family d.66.1.3: Heat shock protein 15 kD [55182] (1 protein)
    there are additional C-terminal structures
  6. 605411Protein Heat shock protein 15 kD [55183] (1 species)
    ribosome-binding protein
  7. 605412Species Escherichia coli [TaxId:562] [55184] (1 PDB entry)
  8. 605413Domain d1dm9a_: 1dm9 A: [39560]

Details for d1dm9a_

PDB Entry: 1dm9 (more details), 2 Å

PDB Description: heat shock protein 15 kd

SCOP Domain Sequences for d1dm9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dm9a_ d.66.1.3 (A:) Heat shock protein 15 kD {Escherichia coli}
pavevrldkwlwaarfyktralaremieggkvhyngqrskpskivelnatltlrqgnder
tvivkaiteqrrpaseaallyeetaesvekrekmalarklnalt

SCOP Domain Coordinates for d1dm9a_:

Click to download the PDB-style file with coordinates for d1dm9a_.
(The format of our PDB-style files is described here.)

Timeline for d1dm9a_: