Lineage for d1c06a_ (1c06 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726401Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
    alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta
  4. 726402Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
    common motif in otherwise different folds
  5. 726403Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
    has a RRF/tRNA synthetase additional domain-like fold
  6. 726404Protein Ribosomal protein S4 [55179] (2 species)
    also contains a Zn-binding N-terminal subdomain
  7. 726405Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries)
  8. 726406Domain d1c06a_: 1c06 A: [39558]

Details for d1c06a_

PDB Entry: 1c06 (more details)

PDB Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (ensemble of 16 structures)
PDB Compounds: (A:) ribosomal protein s4 delta 41

SCOP Domain Sequences for d1c06a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus [TaxId: 1422]}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

SCOP Domain Coordinates for d1c06a_:

Click to download the PDB-style file with coordinates for d1c06a_.
(The format of our PDB-style files is described here.)

Timeline for d1c06a_: