SCOP 1.67: Domain d1c06a_: 1c06 A:

Lineage for d1c06a_ (1c06 A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
   alpha(2)-beta(2)-loop-beta; 2 layers: alpha/beta

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families)
   common motif in otherwise different folds

5. Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
   has a RRF/tRNA synthetase additional domain-like fold

6. Protein Ribosomal protein S4 [55179] (2 species)
   also contains a Zn-binding N-terminal subdomain

7. Species Bacillus stearothermophilus [TaxId:1422] [55181] (2 PDB entries)

8. Domain d1c06a_: 1c06 A: [39558]

Details for d1c06a_

PDB Entry: 1c06

PDB Description: solution structure of ribosomal protein s4 delta 41, refined with dipolar couplings (ensemble of 16 structures)

SCOP Domain Sequences for d1c06a_:

Sequence; same for both SEQRES and ATOM records:

>d1c06a_ d.66.1.2 (A:) Ribosomal protein S4 {Bacillus stearothermophilus}
mklseyglqlqekqklrhmygvnerqfrktfeeagkmpgkhgenfmillesrldnlvyrl
glartrrqarqlvthghilvdgsrvnipsyrvkpgqtiavreksrnlqvikealeannyi
pdylsfdpekmegtytrlperselpaeinealivefysr

Timeline for d1c06a_:

• d1c06a_ first appeared (with stable ids) in SCOP 1.55
  
• d1c06a_ appears in SCOP 1.65
  
• d1c06a_ appears in SCOP 1.69
  
• d1c06a_ appears in the current release, SCOPe 2.08