Lineage for d1hnxd_ (1hnx D:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193185Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 193186Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) (S)
  5. 193191Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 193192Protein Ribosomal protein S4 [55179] (2 species)
  7. 193196Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 193203Domain d1hnxd_: 1hnx D: [39557]
    Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxd_

PDB Entry: 1hnx (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnxd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1hnxd_:

Click to download the PDB-style file with coordinates for d1hnxd_.
(The format of our PDB-style files is described here.)

Timeline for d1hnxd_: