Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (5 families) |
Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) |
Protein Ribosomal protein S4 [55179] (2 species) |
Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries) |
Domain d1hnxd_: 1hnx D: [39557] Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_ |
PDB Entry: 1hnx (more details), 3.4 Å
SCOP Domain Sequences for d1hnxd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1hnxd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus} gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm kgkflrlpdredlalpvneqlviefysr
Timeline for d1hnxd_: