SCOP 1.57: Domain d1hnxd_: 1hnx D:

Lineage for d1hnxd_ (1hnx D:)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)

4. Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families)

5. Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)

6. Protein Ribosomal protein S4 [55179] (2 species)

7. Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)

8. Domain d1hnxd_: 1hnx D: [39557]
   Other proteins in same PDB: d1hnxb_, d1hnxc1, d1hnxc2, d1hnxe1, d1hnxe2, d1hnxf_, d1hnxg_, d1hnxh_, d1hnxi_, d1hnxj_, d1hnxk_, d1hnxl_, d1hnxm_, d1hnxn_, d1hnxo_, d1hnxp_, d1hnxq_, d1hnxr_, d1hnxs_, d1hnxt_, d1hnxv_

Details for d1hnxd_

PDB Entry: 1hnx, 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with pactamycin

SCOP Domain Sequences for d1hnxd_:

Sequence; same for both SEQRES and ATOM records:

>d1hnxd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

Timeline for d1hnxd_:

• d1hnxd_ first appeared (with stable ids) in SCOP 1.55
  
• d1hnxd_ appears in SCOP 1.59
  
• d1hnxd_ appears in the current release, SCOPe 2.08