Lineage for d1hnwd_ (1hnw D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81032Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 81033Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 81038Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 81039Protein Ribosomal protein S4 [55179] (2 species)
  7. 81043Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 81049Domain d1hnwd_: 1hnw D: [39556]
    Other proteins in same PDB: d1hnwb_, d1hnwc1, d1hnwc2, d1hnwe1, d1hnwe2, d1hnwf_, d1hnwg_, d1hnwh_, d1hnwi_, d1hnwj_, d1hnwk_, d1hnwl_, d1hnwm_, d1hnwn_, d1hnwo_, d1hnwp_, d1hnwq_, d1hnwr_, d1hnws_, d1hnwt_, d1hnwv_

Details for d1hnwd_

PDB Entry: 1hnw (more details), 3.4 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit in complex with tetracycline

SCOP Domain Sequences for d1hnwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hnwd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvneqlviefysr

SCOP Domain Coordinates for d1hnwd_:

Click to download the PDB-style file with coordinates for d1hnwd_.
(The format of our PDB-style files is described here.)

Timeline for d1hnwd_: