Lineage for d1hr0d_ (1hr0 D:)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 81032Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily)
  4. 81033Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) (S)
  5. 81038Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein)
  6. 81039Protein Ribosomal protein S4 [55179] (2 species)
  7. 81043Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries)
  8. 81048Domain d1hr0d_: 1hr0 D: [39554]
    Other proteins in same PDB: d1hr0b_, d1hr0c1, d1hr0c2, d1hr0e1, d1hr0e2, d1hr0f_, d1hr0g_, d1hr0h_, d1hr0i_, d1hr0j_, d1hr0k_, d1hr0l_, d1hr0m_, d1hr0n_, d1hr0o_, d1hr0p_, d1hr0q_, d1hr0r_, d1hr0s_, d1hr0t_, d1hr0v_, d1hr0w_

Details for d1hr0d_

PDB Entry: 1hr0 (more details), 3.2 Å

PDB Description: crystal structure of initiation factor if1 bound to the 30s ribosomal subunit

SCOP Domain Sequences for d1hr0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hr0d_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr

SCOP Domain Coordinates for d1hr0d_:

Click to download the PDB-style file with coordinates for d1hr0d_.
(The format of our PDB-style files is described here.)

Timeline for d1hr0d_: