SCOPe 2.08: Domain d1fsic_: 1fsi C:

Lineage for d1fsic_ (1fsi C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.61: LigT-like [55143] (1 superfamily)
   duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III

4. Superfamily d.61.1: LigT-like [55144] (5 families)

5. Family d.61.1.1: tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55145] (1 protein)
   automatically mapped to Pfam PF07823

6. Protein tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase [55146] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [55147] (3 PDB entries)

8. Domain d1fsic_: 1fsi C: [39538]
   Other proteins in same PDB: d1fsia2
   CASP4
   complexed with so4

Details for d1fsic_

PDB Entry: 1fsi, 2.5 Å

PDB Description: crystal structure of cyclic nucleotide phosphodiesterase of appr>p from arabidopsis thaliana

PDB Compounds: (C:) cyclic phosphodiesterase

SCOPe Domain Sequences for d1fsic_:

Sequence, based on SEQRES records:

>d1fsic_ d.61.1.1 (C:) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehcknhfncstttpymphl
sllyaelteeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnln
p

Sequence, based on observed residues (ATOM records):

>d1fsic_ d.61.1.1 (C:) tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meevkkdvysvwalpdeeseprfkklmealrseftgprfvphvtvavsayltadeakkmf
esacdglkaytatvdrvstgtfffqcvflllqttpevmeagehccstpymphlsllyael
teeekknaqekaytldssldglsfrlnrlalcktdtedktletwetvavcnlnp

Timeline for d1fsic_:

• d1fsic_ first appeared (with stable ids) in SCOP 1.55
  
• d1fsic_ appears in SCOPe 2.07