Lineage for d6l9mg1 (6l9m G:0-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938555Protein automated matches [191280] (6 species)
    not a true protein
  7. 2938568Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries)
  8. 2938609Domain d6l9mg1: 6l9m G:0-181 [395293]
    Other proteins in same PDB: d6l9ma2, d6l9mb_, d6l9md2, d6l9me_, d6l9mg2, d6l9mh_, d6l9mj2, d6l9mk_
    automated match to d1kjva2

Details for d6l9mg1

PDB Entry: 6l9m (more details), 2.6 Å

PDB Description: h2-ld complexed with ah1 peptide
PDB Compounds: (G:) H2-Ld

SCOPe Domain Sequences for d6l9mg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9mg1 d.19.1.1 (G:0-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpey
weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd
gcdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl
lr

SCOPe Domain Coordinates for d6l9mg1:

Click to download the PDB-style file with coordinates for d6l9mg1.
(The format of our PDB-style files is described here.)

Timeline for d6l9mg1: