SCOPe 2.07: Domain d6l9ld1: 6l9l D:1-110

Lineage for d6l9ld1 (6l9l D:1-110)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d6l9ld1: 6l9l D:1-110 [395235]
   Other proteins in same PDB: d6l9la_, d6l9lc2, d6l9ld2, d6l9le_, d6l9lg2, d6l9lh2
   automated match to d2ak4e1

Details for d6l9ld1

PDB Entry: 6l9l, 2.4 Å

PDB Description: 1d4 tcr recognition of h2-ld a1a2 a5 peptide complexes

PDB Compounds: (D:) t cell receptor

SCOPe Domain Sequences for d6l9ld1:

Sequence; same for both SEQRES and ATOM records:

>d6l9ld1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqigdvpd
gykatrttqedfflllelaspsqtslyfcassdgdyeqyfgpgtrltvle

Timeline for d6l9ld1:

• d6l9ld1 is new in SCOPe 2.07-stable
  
• d6l9ld1 appears in the current release, SCOPe 2.08