Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (29 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries) |
Domain d6l9ld1: 6l9l D:1-110 [395235] Other proteins in same PDB: d6l9la_, d6l9lc2, d6l9ld2, d6l9le_, d6l9lg2, d6l9lh2 automated match to d2ak4e1 |
PDB Entry: 6l9l (more details), 2.4 Å
SCOPe Domain Sequences for d6l9ld1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9ld1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]} avtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqigdvpd gykatrttqedfflllelaspsqtslyfcassdgdyeqyfgpgtrltvle
Timeline for d6l9ld1: