Lineage for d6l9ld1 (6l9l D:1-110)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756319Domain d6l9ld1: 6l9l D:1-110 [395235]
    Other proteins in same PDB: d6l9la_, d6l9lc2, d6l9ld2, d6l9le_, d6l9lg2, d6l9lh2
    automated match to d2ak4e1

Details for d6l9ld1

PDB Entry: 6l9l (more details), 2.4 Å

PDB Description: 1d4 tcr recognition of h2-ld a1a2 a5 peptide complexes
PDB Compounds: (D:) t cell receptor

SCOPe Domain Sequences for d6l9ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9ld1 b.1.1.0 (D:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avtqsprnkvtvtggnvtlscrqtnshnymywyrqdtghglrlihysygagnlqigdvpd
gykatrttqedfflllelaspsqtslyfcassdgdyeqyfgpgtrltvle

SCOPe Domain Coordinates for d6l9ld1:

Click to download the PDB-style file with coordinates for d6l9ld1.
(The format of our PDB-style files is described here.)

Timeline for d6l9ld1: