Lineage for d6lhha1 (6lhh A:4-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2938649Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2938650Protein automated matches [226842] (5 species)
    not a true protein
  7. 2938653Species Chicken (Gallus gallus) [TaxId:9031] [225828] (15 PDB entries)
  8. 2938662Domain d6lhha1: 6lhh A:4-181 [395212]
    Other proteins in same PDB: d6lhha2, d6lhhb_
    automated match to d1zaga2

Details for d6lhha1

PDB Entry: 6lhh (more details), 2.71 Å

PDB Description: crystal structure of chicken 8mer-bf2*1501
PDB Compounds: (A:) MHC class I

SCOPe Domain Sequences for d6lhha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lhha1 d.19.1.0 (A:4-181) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elhtlryistamtdpgpgqpwyvdvgyvdgelfthynstarravprtewiaantdqqywd
setqtsqrteqidrdglgtlqrrynqtggshtvqlmygcdiledgtirgysqdaydgrdf
iafdkdtmtftaavpeavptkrkweegdyaeglkqyleetcvewlrryveygkaelgr

SCOPe Domain Coordinates for d6lhha1:

Click to download the PDB-style file with coordinates for d6lhha1.
(The format of our PDB-style files is described here.)

Timeline for d6lhha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6lhha2
View in 3D
Domains from other chains:
(mouse over for more information)
d6lhhb_