Lineage for d6l9nd1 (6l9n D:1-182)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2544619Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2544620Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2544621Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2545619Protein automated matches [191280] (6 species)
    not a true protein
  7. 2545632Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)
  8. 2545660Domain d6l9nd1: 6l9n D:1-182 [395205]
    Other proteins in same PDB: d6l9na2, d6l9nb_, d6l9nd2, d6l9ne_, d6l9ng2, d6l9nh_, d6l9nj2, d6l9nk_
    automated match to d1kjva2

Details for d6l9nd1

PDB Entry: 6l9n (more details), 2.6 Å

PDB Description: h2-ld complexed with a5 peptide
PDB Compounds: (D:) MHC

SCOPe Domain Sequences for d6l9nd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9nd1 d.19.1.1 (D:1-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpey
weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd
gcdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl
lr

SCOPe Domain Coordinates for d6l9nd1:

Click to download the PDB-style file with coordinates for d6l9nd1.
(The format of our PDB-style files is described here.)

Timeline for d6l9nd1: