Lineage for d6l9nb_ (6l9n B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2357723Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2357905Domain d6l9nb_: 6l9n B: [395176]
    Other proteins in same PDB: d6l9na1, d6l9na2, d6l9nd1, d6l9nd2, d6l9ng1, d6l9ng2, d6l9nj1, d6l9nj2
    automated match to d1lk2b_

Details for d6l9nb_

PDB Entry: 6l9n (more details), 2.6 Å

PDB Description: h2-ld complexed with a5 peptide
PDB Compounds: (B:) b2m

SCOPe Domain Sequences for d6l9nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l9nb_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d6l9nb_:

Click to download the PDB-style file with coordinates for d6l9nb_.
(The format of our PDB-style files is described here.)

Timeline for d6l9nb_: