Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.1: Homeodomain-like [46689] (20 families) consists only of helices |
Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
Protein automated matches [190674] (25 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [233791] (2 PDB entries) |
Domain d6l9jl_: 6l9j L: [395140] automated match to d5gjka_ complexed with gol |
PDB Entry: 6l9j (more details), 2.64 Å
SCOPe Domain Sequences for d6l9jl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l9jl_ a.4.1.0 (L:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} aheivipsyskwfnlekihsievqslpefftnripsktpevymryrnfmvnsyrlnpney fsvttarrnvsgdaaalfrlhkfltkwglinyqvd
Timeline for d6l9jl_: