SCOPe 2.07: Domain d6l9ng1: 6l9n G:1-182

Lineage for d6l9ng1 (6l9n G:1-182)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (33 PDB entries)

8. Domain d6l9ng1: 6l9n G:1-182 [395119]
   Other proteins in same PDB: d6l9na2, d6l9nb_, d6l9nd2, d6l9ne_, d6l9ng2, d6l9nh_, d6l9nj2, d6l9nk_
   automated match to d1kjva2

Details for d6l9ng1

PDB Entry: 6l9n, 2.6 Å

PDB Description: h2-ld complexed with a5 peptide

PDB Compounds: (G:) MHC

SCOPe Domain Sequences for d6l9ng1:

Sequence; same for both SEQRES and ATOM records:

>d6l9ng1 d.19.1.1 (G:1-182) automated matches {Human (Homo sapiens) [TaxId: 9606]}
agphsmryfetavsrpglgepryisvgyvdnkefvrfdsdaenpryepqapwmeqegpey
weritqiakgqeqwfrvnlrtllgyynqsaggthtlqwmygcdvgsdgrllrgyeqfayd
gcdyialnedlktwtaadmaaqitrrkweqagaaeyyraylegecvewlhrylkngnatl
lr

Timeline for d6l9ng1:

• d6l9ng1 is new in SCOPe 2.07-stable
  
• d6l9ng1 appears in the current release, SCOPe 2.08