Lineage for d7khvc3 (7khv C:496-624)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351179Fold a.246: Hyaluronidase domain-like [140656] (3 superfamilies)
    5 helices; bundle, closed, left-handed twist; up-and-down (meander) topology
  4. 2351180Superfamily a.246.1: Hyaluronidase post-catalytic domain-like [140657] (2 families) (S)
  5. 2351212Family a.246.1.0: automated matches [254242] (1 protein)
    not a true family
  6. 2351213Protein automated matches [254554] (3 species)
    not a true protein
  7. 2351220Species Clostridium perfringens [TaxId:1502] [255691] (3 PDB entries)
  8. 2351225Domain d7khvc3: 7khv C:496-624 [395009]
    Other proteins in same PDB: d7khva1, d7khva2, d7khvb1, d7khvb2, d7khvc1, d7khvc2, d7khvd1, d7khvd2, d7khve1, d7khve2, d7khvf1
    automated match to d2v5ca3
    complexed with ca, cl, so4, x1a

Details for d7khvc3

PDB Entry: 7khv (more details), 2.3 Å

PDB Description: cpoga in complex with ligand 54
PDB Compounds: (C:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khvc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7khvc3 a.246.1.0 (C:496-624) automated matches {Clostridium perfringens [TaxId: 1502]}
edapelrakmdelwnklsskedasalieelygefarmeeacnnlkanlpevaleecsrql
delitlaqgdkasldmivaqlnedteayesakeiaqnklntalssfavisekvaqsfiqe
alsfdltli

SCOPe Domain Coordinates for d7khvc3:

Click to download the PDB-style file with coordinates for d7khvc3.
(The format of our PDB-style files is described here.)

Timeline for d7khvc3: