Lineage for d7khvc1 (7khv C:40-178)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2571709Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (4 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 2571811Family d.92.2.0: automated matches [227269] (1 protein)
    not a true family
  6. 2571812Protein automated matches [227062] (5 species)
    not a true protein
  7. 2571819Species Clostridium perfringens [TaxId:1502] [255689] (3 PDB entries)
  8. 2571824Domain d7khvc1: 7khv C:40-178 [395007]
    Other proteins in same PDB: d7khva2, d7khva3, d7khvb2, d7khvb3, d7khvc2, d7khvc3, d7khvd2, d7khvd3, d7khve2, d7khve3, d7khvf1, d7khvf2
    automated match to d2v5ca1
    complexed with ca, cl, so4, x1a

Details for d7khvc1

PDB Entry: 7khv (more details), 2.3 Å

PDB Description: cpoga in complex with ligand 54
PDB Compounds: (C:) O-GlcNAcase nagJ

SCOPe Domain Sequences for d7khvc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7khvc1 d.92.2.0 (C:40-178) automated matches {Clostridium perfringens [TaxId: 1502]}
qvlvpnlnptpenlevvgdgfkitssinlvgeeeadenavnalrefltannieinsendp
nsttliigevdddipeldealngttaenlkeegyalvsndgkiaiegkdgdgtfygvqtf
kqlvkesnipevnitdypt

SCOPe Domain Coordinates for d7khvc1:

Click to download the PDB-style file with coordinates for d7khvc1.
(The format of our PDB-style files is described here.)

Timeline for d7khvc1: