Lineage for d1dj0b2 (1dj0 B:115-270)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329948Superfamily d.58.35: Pseudouridine synthase [55120] (3 families) (S)
    duplication: contains two subdomains of this fold
  5. 329949Family d.58.35.1: Pseudouridine synthase I [55121] (1 protein)
  6. 329950Protein Pseudouridine synthase I [55122] (1 species)
  7. 329951Species Escherichia coli [TaxId:562] [55123] (1 PDB entry)
  8. 329955Domain d1dj0b2: 1dj0 B:115-270 [39500]
    complexed with cl

Details for d1dj0b2

PDB Entry: 1dj0 (more details), 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution

SCOP Domain Sequences for d1dj0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dj0b2 d.58.35.1 (B:115-270) Pseudouridine synthase I {Escherichia coli}
arryryiiynhrlrpavlskgvthfyepldaermhraaqcllgendftsfravqcqsrtp
wrnvmhinvtrhgpyvvvdikanafvhhmvrnivgslmevgahnqpeswiaellaakdrt
laaatakaeglylvavdypdrydlpkppmgplflad

SCOP Domain Coordinates for d1dj0b2:

Click to download the PDB-style file with coordinates for d1dj0b2.
(The format of our PDB-style files is described here.)

Timeline for d1dj0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dj0b1