SCOP 1.65: Domain d1dj0b1: 1dj0 B:7-114

Lineage for d1dj0b1 (1dj0 B:7-114)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.35: Pseudouridine synthase [55120] (3 families)
   duplication: contains two subdomains of this fold

5. Family d.58.35.1: Pseudouridine synthase I [55121] (1 protein)

6. Protein Pseudouridine synthase I [55122] (1 species)

7. Species Escherichia coli [TaxId:562] [55123] (1 PDB entry)

8. Domain d1dj0b1: 1dj0 B:7-114 [39499]

Details for d1dj0b1

PDB Entry: 1dj0, 1.5 Å

PDB Description: the crystal structure of e. coli pseudouridine synthase i at 1.5 angstrom resolution

SCOP Domain Sequences for d1dj0b1:

Sequence; same for both SEQRES and ATOM records:

>d1dj0b1 d.58.35.1 (B:7-114) Pseudouridine synthase I {Escherichia coli}
ppvykialgieydgskyygwqrqnevrsvqeklekalsqvanepitvfcagrtdagvhgt
gqvvhfettalrkdaawtlgvnanlpgdiavrwvktvpddfharfsat

Timeline for d1dj0b1:

• d1dj0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1dj0b1 appears in SCOP 1.63
  
• d1dj0b1 does not appear in SCOP 1.67