SCOPe 2.08: Domain d7k7eb3: 7k7e B:381-535

Lineage for d7k7eb3 (7k7e B:381-535)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.1: Diphtheria toxin, C-terminal domain [49380] (2 families)
   automatically mapped to Pfam PF01324

5. Family b.2.1.0: automated matches [254321] (1 protein)
   not a true family

6. Protein automated matches [254735] (1 species)
   not a true protein

7. Species Corynebacterium diphtheriae [TaxId:1717] [256178] (7 PDB entries)

8. Domain d7k7eb3: 7k7e B:381-535 [394853]
   Other proteins in same PDB: d7k7ea1, d7k7ea2, d7k7ea4, d7k7eb1, d7k7eb2, d7k7eb4
   automated match to d1f0la1

Details for d7k7eb3

PDB Entry: 7k7e, 2.3 Å

PDB Description: crystal structure of diphtheria toxin from crystals obtained at ph 7.0

PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d7k7eb3:

Sequence, based on SEQRES records:

>d7k7eb3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqktvdhtkvnsklslffeiks

Sequence, based on observed residues (ATOM records):

>d7k7eb3 b.2.1.0 (B:381-535) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
spghktqpflhdgyavswntvedsiirtgfqgesghdikitaentplpiagvllptipgk
ldvnkskthisvngrkirmrcraidgdvtfcrpkspvyvgngvhanlhvafhrsssekih
sneissdsigvlgyqkkvnsklslffeiks

Timeline for d7k7eb3:

• d7k7eb3 first appeared in SCOPe 2.07