SCOPe 2.08: Domain d7k7za3: 7k7z A:550-668

Lineage for d7k7za3 (7k7z A:550-668)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.0: automated matches [191311] (1 protein)
   not a true family

6. Protein automated matches [190052] (8 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186914] (120 PDB entries)

8. Domain d7k7za3: 7k7z A:550-668 [394821]
   Other proteins in same PDB: d7k7za1, d7k7za2, d7k7zb_, d7k7zg_
   automated match to d3krwa3
   complexed with w4g

Details for d7k7za3

PDB Entry: 7k7z, 2.61 Å

PDB Description: structure of a hit for g protein coupled receptor kinase 2 (grk2) inhibitor for the potential treatment of heart failure

PDB Compounds: (A:) Beta-adrenergic receptor kinase 1

SCOPe Domain Sequences for d7k7za3:

Sequence; same for both SEQRES and ATOM records:

>d7k7za3 b.55.1.0 (A:550-668) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eedyalgkdcimhgymskmgnpfltqwqrryfylfpnrlewrgegeapqslltmeeiqsv
eetqikerkclllkirggkqfilqcdsdpelvqwkkelrdayreaqqlvqrvpkmknkp

Timeline for d7k7za3:

• d7k7za3 first appeared in SCOPe 2.07